Protein Info for LRK53_RS15375 in Rhodanobacter sp000427505 FW510-R12

Annotation: glycosyltransferase, exosortase A system-associated

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 TIGR04063: PEP-CTERM/exosortase A-associated glycosyltransferase, Daro_2409 family" amino acids 23 to 420 (398 residues), 606.8 bits, see alignment E=8.6e-187 PF13579: Glyco_trans_4_4" amino acids 37 to 211 (175 residues), 88.1 bits, see alignment E=2.1e-28 PF13439: Glyco_transf_4" amino acids 43 to 217 (175 residues), 77.2 bits, see alignment E=4e-25 PF00534: Glycos_transf_1" amino acids 239 to 384 (146 residues), 99.9 bits, see alignment E=3e-32 PF13692: Glyco_trans_1_4" amino acids 239 to 383 (145 residues), 113 bits, see alignment E=3.6e-36 PF13524: Glyco_trans_1_2" amino acids 267 to 411 (145 residues), 31.4 bits, see alignment E=4.3e-11

Best Hits

KEGG orthology group: None (inferred from 63% identity to hse:Hsero_2750)

Predicted SEED Role

"Glycosyl transferase, group 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (433 amino acids)

>LRK53_RS15375 glycosyltransferase, exosortase A system-associated (Rhodanobacter sp000427505 FW510-R12)
MNHSPRAALQQDRSGASAERPLRILHVLDHSLPLHSGYTFRTLAILEAQRALGWETMQLT
GPRQGDDRQREEQVGDWTFYRTPPATGLLAGLPLLRYRCLMRALQTRLAEVVDSVRPDIL
HAHSPVLDALPALAVGRAAGIPVVYEVRAFWEDAAVDLGTAREGGARYRLTRALETRALQ
RADAVTTICDGLRGDMLERGIPADKVTVIPNAVDTARFRSTTSVDAELLGKYGLVRGYTL
GFAGSFYAYEGLDALLRAMPLVLRAVPQARLLLLGGGPQEAALRALAARLGLEREVHFVG
RVPHGEVTRYYGVMDVMVYPRISRRLTELVTPLKPLEAMAMGKLVAASDVGGHRELIRDG
RNGHLFPAGSAEALAQCLIELLTTHAGWDKVIANGQAFVERERTWSASVARYRAVYADVL
DRRRRGAGGAHDR