Protein Info for LRK53_RS15160 in Rhodanobacter sp000427505 FW510-R12

Annotation: flagellar hook protein FlgE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 TIGR03506: flagellar hook-basal body protein" amino acids 2 to 388 (387 residues), 330 bits, see alignment E=1.3e-102 PF00460: Flg_bb_rod" amino acids 3 to 33 (31 residues), 34.5 bits, see alignment (E = 3.2e-12) PF22692: LlgE_F_G_D1" amino acids 83 to 124 (42 residues), 44.7 bits, see alignment 2.5e-15 PF07559: FlgE_D2" amino acids 161 to 286 (126 residues), 85.8 bits, see alignment E=8.1e-28 PF06429: Flg_bbr_C" amino acids 359 to 405 (47 residues), 44.3 bits, see alignment 2.1e-15

Best Hits

KEGG orthology group: K02390, flagellar hook protein FlgE (inferred from 51% identity to psu:Psesu_1518)

Predicted SEED Role

"Flagellar hook protein FlgE" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (407 amino acids)

>LRK53_RS15160 flagellar hook protein FlgE (Rhodanobacter sp000427505 FW510-R12)
MPFNIALSGLNAASKDLEVTANNIANTATTGFKGSRTQFAELFNAAGPNLSSSQTGSGVR
LTNVAQQFTAGSVETTNNSLDFAISGNGFFTVHDGKGYSYTRAGAFQKDQNGYVMNASGQ
RLQVFPPVAGGTFDTSTLTDLQLFTAQNAAKATGTVQMSLNLPSDATPPATPFKPLTDPS
SYNQATPFTAYDSLGATHSGVVYFVKDPAANVWNASLYIDGGSTGASQQLTFNSSGALVK
PANGMLNFPAVSVSPGANPMQLTLDMSKATQFGNAYAASAINQNGYPTGILSSIDVSREG
VVQAKYSNGQTSALGQLALAQFSNEQGLRQLDNTNWAASYDSGTPVMGAAGGGTFGSVQA
GALEASNTADLTAQLVNMIKAQRNYQANAQVISTDNQLTQTIINIRN