Protein Info for LRK53_RS15110 in Rhodanobacter sp000427505 FW510-R12

Annotation: flagellar filament capping protein FliD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 PF02465: FliD_N" amino acids 23 to 119 (97 residues), 83.6 bits, see alignment E=1.9e-27 PF07196: Flagellin_IN" amino acids 138 to 193 (56 residues), 29.8 bits, see alignment 8.3e-11 PF07195: FliD_C" amino acids 233 to 447 (215 residues), 170.4 bits, see alignment E=7.2e-54

Best Hits

KEGG orthology group: K02407, flagellar hook-associated protein 2 (inferred from 44% identity to bcm:Bcenmc03_0222)

Predicted SEED Role

"Flagellar hook-associated protein FliD" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (465 amino acids)

>LRK53_RS15110 flagellar filament capping protein FliD (Rhodanobacter sp000427505 FW510-R12)
MAITVGSTSTPTTGLLTSLGVGSGLDVATLVSQLVAAKKAPQQNQITSQTNTANTQLSAL
GQVSAALSALQSAMATLTDGSAFTARTVASSDTTVLGASATGTPVNGSYNIVVTQLATAL
KASSGAFANSSTAVGTGTLTIAVGSQSMSLTLDSTNNSLAAIRDAINGASSNPGVSATIV
TGTDGAHLVLSGTRTGAANGFSVSSSGGDGKLAALNYNPAATSGNGLTVVTAAADAKYSI
DGLAASSAGNTVSTAIDGLTLNLVKAGSSTLSVSSDTSKATSALTNLVNTYNSFVGIYQN
LTKYDATSGTAGALLGDATLNRINNTLSSVIGGTANGAALSSIGISLQVDGTLRLDSAKL
ATALSDGGKQVGSLFGGTNGFAAKLNTPLTSWVGTQGVLASRTSSINRQLSDLANQQTTL
NSRMASLTAMYQAQFSALDTLMSKLNSTSTYLQQQFDALTNSSKK