Protein Info for LRK53_RS15020 in Rhodanobacter sp000427505 FW510-R12

Annotation: flagellar biosynthetic protein FliR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 42 to 62 (21 residues), see Phobius details amino acids 73 to 94 (22 residues), see Phobius details amino acids 127 to 150 (24 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 211 to 232 (22 residues), see Phobius details PF01311: Bac_export_1" amino acids 15 to 242 (228 residues), 203.4 bits, see alignment E=1.9e-64 TIGR01400: flagellar biosynthetic protein FliR" amino acids 16 to 254 (239 residues), 199.6 bits, see alignment E=3.1e-63

Best Hits

Swiss-Prot: 36% identical to FLIR_PECCC: Flagellar biosynthetic protein FliR (fliR) from Pectobacterium carotovorum subsp. carotovorum

KEGG orthology group: K02421, flagellar biosynthetic protein FliR (inferred from 42% identity to tgr:Tgr7_1333)

Predicted SEED Role

"Flagellar biosynthesis protein FliR" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (256 amino acids)

>LRK53_RS15020 flagellar biosynthetic protein FliR (Rhodanobacter sp000427505 FW510-R12)
MTALDLAQLPTWLGSLFWAVGRVSGLCLVAPVFSATVVSARIRIGVVVVLSLVLAPLAPA
TIDPLSGDGVATMAGQVLVGAAVGFVLKLVFEAVSFGGELVGQSMSLGFAEVVNPQAGGS
ANVLSEFYLLLVTLLFLAMDGHLRLIALLADSFHSLPPGMPAIDASGLHAVASFAAELFS
GAVRVALPAMTSLLVVNVGFAAISRAAPSMNLFAVGFPITVSLGFIALWLALRSLPGAFA
ALQDDAWSLMRNLLGG