Protein Info for LRK53_RS14825 in Rhodanobacter sp000427505 FW510-R12

Annotation: cytochrome c1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 219 to 237 (19 residues), see Phobius details PF02167: Cytochrom_C1" amino acids 37 to 244 (208 residues), 76.5 bits, see alignment E=1.2e-25

Best Hits

Swiss-Prot: 52% identical to CY1_ALLVD: Cytochrome c1 (petC) from Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)

KEGG orthology group: K00413, ubiquinol-cytochrome c reductase cytochrome c1 subunit [EC: 1.10.2.2] (inferred from 62% identity to xal:XALc_1266)

Predicted SEED Role

"ubiquinol cytochrome C oxidoreductase, cytochrome C1 subunit" in subsystem Ubiquinone Menaquinone-cytochrome c reductase complexes

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.10.2.2

Use Curated BLAST to search for 1.10.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (246 amino acids)

>LRK53_RS14825 cytochrome c1 (Rhodanobacter sp000427505 FW510-R12)
MKRYIFPVALAFGLVVGGAPAQAAEGGGLPHAGTNVQDQASLQRGAKLFFNYCVGCHSLK
YMRYERIASDLGLTEQDVMQNLNFTGAKFGETVVSHMPEADATKWFGKAPPDLSLEVRAK
GADWVYAYLNSFYLDPNRPVGWNNTVFPNASMPFPLWELQGLQTAVMTEAKPGEDARVEK
LVLSQPGKLTPAQFQQASRDLTTFLEYASEPAALQRHHYGVWVLLFLAFFTFLSAMLKKE
YWKDVH