Protein Info for LRK53_RS14710 in Rhodanobacter sp000427505 FW510-R12

Annotation: quinolinate synthase NadA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 TIGR00550: quinolinate synthetase complex, A subunit" amino acids 45 to 335 (291 residues), 317.8 bits, see alignment E=3.6e-99 PF02445: NadA" amino acids 45 to 334 (290 residues), 370.9 bits, see alignment E=2.1e-115

Best Hits

Swiss-Prot: 61% identical to NADA2_RHILO: Quinolinate synthase A 2 (nadA2) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K03517, quinolinate synthase [EC: 2.5.1.72] (inferred from 58% identity to pla:Plav_0734)

MetaCyc: 40% identical to quinolinate synthase (Thermotoga maritima)
Quinolinate synthase. [EC: 2.5.1.72]

Predicted SEED Role

"Quinolinate synthetase (EC 2.5.1.72)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.5.1.72)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (341 amino acids)

>LRK53_RS14710 quinolinate synthase NadA (Rhodanobacter sp000427505 FW510-R12)
MSASATLPVPVWRDELEHEYAALAERLEPLVPCLEIPLHLPWIDAINKLKKQRGAVIMAH
SYQSPEIFHGVADVTGDSLGLAQAAAKCEADLIVLCGVHFMAETAKILAPHKTVLIPDLE
AGCSLASSITAADVRALRAQHPGTPVVSYANTSAAVKAESDAICTSANAVQVVEAMGTPK
VIFLPDEFLGKHVAKQTQVEIILWHGRCEVHERFTAQEVRHVREQFGTRVVAHPECSPEV
LAEADFVGSTTAMGKWLAREKPARVAMITECSMADNLKSQFPQTEFIKPCNLCPHMQRIT
LQNIYACLRDLRHAIEIPAEVSVRARAALERMLAIGRRESV