Protein Info for LRK53_RS14685 in Rhodanobacter sp000427505 FW510-R12

Annotation: deoxyribose-phosphate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 TIGR00126: deoxyribose-phosphate aldolase" amino acids 15 to 227 (213 residues), 183.9 bits, see alignment E=1.4e-58 PF01791: DeoC" amino acids 18 to 212 (195 residues), 69.4 bits, see alignment E=1.9e-23

Best Hits

Swiss-Prot: 50% identical to DEOC_ERWT9: Deoxyribose-phosphate aldolase (deoC) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K01619, deoxyribose-phosphate aldolase [EC: 4.1.2.4] (inferred from 56% identity to mex:Mext_2965)

MetaCyc: 46% identical to deoxyribose-phosphate aldolase (Escherichia coli K-12 substr. MG1655)
Deoxyribose-phosphate aldolase. [EC: 4.1.2.4]

Predicted SEED Role

"Deoxyribose-phosphate aldolase (EC 4.1.2.4)" in subsystem Deoxyribose and Deoxynucleoside Catabolism (EC 4.1.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (247 amino acids)

>LRK53_RS14685 deoxyribose-phosphate aldolase (Rhodanobacter sp000427505 FW510-R12)
MPDDARSPRALATRLLSLLDLTSLGENDTPARIEALCAAALAAPVLPAALCVYPEHVAGA
RRQLQGSAIKLATVVNFPDGGGDPARVERETQRALAAGADEIDLVLPYRALLAGDAATAG
AVVRAGRAVCSDGVVLKLIIESGELGSAERIRQACAIGLDAGVDFLKTSTGKVPLNATPA
AAAVMLDAIAEAGGRCGFKAAGGIRTLADAAAYLALAEARLGPGWADPAHFRIGASALFG
ELVAATS