Protein Info for LRK53_RS14375 in Rhodanobacter sp000427505 FW510-R12

Annotation: excinuclease ABC subunit UvrB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 674 TIGR00631: excinuclease ABC subunit B" amino acids 4 to 669 (666 residues), 1052.3 bits, see alignment E=0 PF04851: ResIII" amino acids 16 to 87 (72 residues), 39.1 bits, see alignment E=2.7e-13 PF17757: UvrB_inter" amino acids 160 to 249 (90 residues), 109.4 bits, see alignment E=2.8e-35 PF27431: UvrB_3rd" amino acids 255 to 314 (60 residues), 102.2 bits, see alignment 4e-33 PF00271: Helicase_C" amino acids 437 to 545 (109 residues), 70.8 bits, see alignment E=4e-23 PF12344: UvrB" amino acids 552 to 593 (42 residues), 73.2 bits, see alignment 4.2e-24 PF02151: UVR" amino acids 639 to 671 (33 residues), 37.8 bits, see alignment (E = 4.1e-13)

Best Hits

Swiss-Prot: 78% identical to UVRB_XANAC: UvrABC system protein B (uvrB) from Xanthomonas axonopodis pv. citri (strain 306)

KEGG orthology group: K03702, excinuclease ABC subunit B (inferred from 78% identity to sml:Smlt1628)

MetaCyc: 69% identical to UvrABC excision nuclease subunit B (Escherichia coli K-12 substr. MG1655)
3.1.25.-

Predicted SEED Role

"Excinuclease ABC subunit B" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (674 amino acids)

>LRK53_RS14375 excinuclease ABC subunit UvrB (Rhodanobacter sp000427505 FW510-R12)
MTDRFQLVAPYQPAGDQPQAIARLADGFEAGLAAQTLLGVTGSGKTYTIANMIERVQRPT
IVMAPNKTLAAQLYGEFREFFPHNAVEYFVSYYDYYQPEAYVVASDTFIEKDSSINEHIE
QMRLSATKALLSRRDSIIVATVSAIYGLGNPEDYLSLRLILATGERIDQRKLIHQLTELQ
YTRNETELRRGTYRVRGEIVDVFPAESETEALRIELFDGEVEKMALFDPLTGETIRKVQR
YTVYPRTHYASTRESVLNAIETIKLELKDRLEYLYKENKLVEAQRLEQRTRFDLEMMAEV
GYCQGIENYSRHLTRRAPGEPPPTLFDYLPADGLLVVDESHVTVPQLGAMYKGDRSRKET
LVEFGFRLPSAMDNRPLRFEEWEERVPRAIYVSATPRDYELHKSGDAVTELVVRPTGLVD
PEVEVRPVRTQVDDLLSEVHKRVALGDRVLVTTLTKRMAENLTEYLAEHDVKVRYLHSDI
ETVERSEIIRDLRLGEFDVLVGINLLREGLDMPEVSLVAVLDADKEGFLRSTGSLIQTIG
RAARNVRGKAILYADNVTRSMQAAMDETARRREKQVVFNEAHGITPKTVVRRIADIMEGA
RSEAGNRRGGKSSTRGRAAVAEPAAEYAGLSPQQAAGAIRKLEAQMYKHAQNLEFEDAAR
LRDQIHQLREQALR