Protein Info for LRK53_RS14305 in Rhodanobacter sp000427505 FW510-R12

Annotation: NosR/NirI family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 731 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 424 to 445 (22 residues), see Phobius details amino acids 457 to 483 (27 residues), see Phobius details amino acids 494 to 515 (22 residues), see Phobius details amino acids 520 to 538 (19 residues), see Phobius details amino acids 558 to 578 (21 residues), see Phobius details amino acids 596 to 615 (20 residues), see Phobius details amino acids 622 to 638 (17 residues), see Phobius details PF04205: FMN_bind" amino acids 84 to 165 (82 residues), 28.9 bits, see alignment E=2.1e-10 PF12801: Fer4_5" amino acids 498 to 543 (46 residues), 52.1 bits, see alignment 7.5e-18 amino acids 601 to 644 (44 residues), 25.7 bits, see alignment 1.3e-09 PF27538: NosR" amino acids 646 to 702 (57 residues), 78.7 bits, see alignment 3.4e-26

Best Hits

KEGG orthology group: None (inferred from 52% identity to psa:PST_3551)

Predicted SEED Role

"Nitrous oxide reductase maturation protein NosR" in subsystem Denitrification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (731 amino acids)

>LRK53_RS14305 NosR/NirI family protein (Rhodanobacter sp000427505 FW510-R12)
MRGARPRSLIARLLLALLLLAPASVALASIDAKYPQLHQVFPEAERYGDIEGTPPAAAVY
HGDKVIGYVFETVMVAPVPAYSGAPINILVSIGTDGTIRDARVLEQHEPILLVGIPVQRL
YDFVARYIGHRVDDKIVVGGGASGSVRIDAISSATVTSMVANETIMNSALKVAASRKLIA
GAADTGAAAAQVRADYFVPADWQTLTGNGTIGHLRLARQAIADAFKGQPESGLVDDPTAP
APGHGADTFIDLYFADVTPPTVGRNLLGPTAHADLMKQLKPGDSAIAVMANGIYSFKGVG
YVRGGIFDRVHLLQDGKLVLFKDSDLVQLNDTPLRGKPAFAEQAIFIVRNGGSGFDATRP
WTLQLLVNRQVGPLQSIYHTFTRDYRMPAAYTTRPEAAAEADADALPADAPLWQKVWHGR
RLDIALLVAGLTVLTLILMFQDWIVTRPHLLERLRVGFLIYTLVFIGWYGLAQLSVVNIL
TFIQAMLHGFHWSTFLMDPLVFILWVFVAATLLLLGRGIYCGWLCPFGALQVLVNKLARR
LHVPQFEVPQYLHERLWAIKYIVLLVLFGMSLQSLNMAERYAEIEPFKTAITLHFARSWS
YVLYALALVVVAAFNNKFYCRYVCPLGAGLAVSGRFHLFEWLRRRKECGRPCQICANECE
VKAINAIGQINFNECHYCLDCQVTYANDQKCPPLVERRKKRERAARPLPTPVLTITPAAT
PETNEPAKVAD