Protein Info for LRK53_RS14165 in Rhodanobacter sp000427505 FW510-R12

Annotation: fluoride efflux transporter CrcB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 128 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 35 to 56 (22 residues), see Phobius details amino acids 68 to 86 (19 residues), see Phobius details amino acids 98 to 122 (25 residues), see Phobius details PF02537: CRCB" amino acids 8 to 119 (112 residues), 94.7 bits, see alignment E=2e-31 TIGR00494: protein CrcB" amino acids 8 to 121 (114 residues), 87.3 bits, see alignment E=4.9e-29

Best Hits

Swiss-Prot: 60% identical to CRCB_NITMU: Putative fluoride ion transporter CrcB (crcB) from Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)

KEGG orthology group: K06199, CrcB protein (inferred from 61% identity to meh:M301_1510)

MetaCyc: 41% identical to F- channel (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-498

Predicted SEED Role

"CrcB protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (128 amino acids)

>LRK53_RS14165 fluoride efflux transporter CrcB (Rhodanobacter sp000427505 FW510-R12)
MGLNGFVAIGIGGALGCWLRWGLGVLLNPVFPTLPLGTLAANLAGGLLMGCVMGLFDHFQ
TLSPALRLFVFTGFLGGLTTFSTFSAESATLLLRQQYLWFSGHVAVHVAGSLAMTVLGIA
LTRSLLRH