Protein Info for LRK53_RS14105 in Rhodanobacter sp000427505 FW510-R12

Annotation: sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 44 to 63 (20 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 105 to 135 (31 residues), see Phobius details amino acids 144 to 167 (24 residues), see Phobius details PF07730: HisKA_3" amino acids 200 to 263 (64 residues), 54.7 bits, see alignment E=6.1e-19

Best Hits

KEGG orthology group: None (inferred from 49% identity to xal:XALc_0897)

Predicted SEED Role

"two-component system sensor protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (407 amino acids)

>LRK53_RS14105 sensor histidine kinase (Rhodanobacter sp000427505 FW510-R12)
MRWPFINHIRLLRYAGFFTYLSAGTPLVTSWATERLDQLHRPNFSLLLWTLCYLIFGLMY
WLLTSNLGSRRYPGLKLLGLTLMTAAAVAVGWYSHSGLSAMLMVVASLVLPWLLPFWLAA
SWLVLQHLSLVAVFATFPEYDHSIAVGFIQASIYLGISVLVFITSTVASQQAEQREVQRR
LNSELRATRALLAESSRIAERMRIARDLHDLIGHHLTALSLNLEVASHLSNEAACAHVRK
AQGTAKLLLADVREVVSELRQDDAIDLTQALRSLTEGVPGLNVHVIMPPRFSVEDPRRAQ
VLLRCAQEIITNTAKHAGARNLWLNFAYAGENLLGLHARDDGRGAENVEPGNGLSGMRER
LAEFGGSVVLDTGLSQGFALTVRLPLGEHIALAHAPTRLEPPALNVS