Protein Info for LRK53_RS14000 in Rhodanobacter sp000427505 FW510-R12

Annotation: bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 728 PF22020: RlmL_1st" amino acids 3 to 58 (56 residues), 69.4 bits, see alignment 5.2e-23 PF02926: THUMP" amino acids 66 to 153 (88 residues), 63.8 bits, see alignment E=4e-21 PF01170: UPF0020" amino acids 162 to 376 (215 residues), 163.4 bits, see alignment E=1.4e-51 PF10672: Methyltrans_SAM" amino acids 489 to 664 (176 residues), 72.1 bits, see alignment E=1.3e-23

Best Hits

Predicted SEED Role

"23S rRNA (guanine-N-2-) -methyltransferase rlmL EC 2.1.1.-)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (728 amino acids)

>LRK53_RS14000 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL (Rhodanobacter sp000427505 FW510-R12)
MSQYFATCPKGMEYLLRDELAALGALDVREALAGAHFAGTLETAYRACLWSRLASRILLP
LAEFDAADDEALYRGVQAIDWSEHLAAHATFAVDAGTALSKLTHSQFIGLRVKDAVVDQF
RQRDGSRPGIDTEEPDIRINLRLRRDRAIVSLDLAGSPLHRRGWREEQGEAPLKENLASA
MLLRAHWPEVYAAGGALLDPMCGSGTLLIEGALMAADVAPGLRREYFGFLGWQQHDIALW
RSLLDEAQQRAEAGLRALRPCFFGSDADPRMVQTAKRNAQQAGVAGFFTLDRQDMAHAAP
PPGIDHGLVITNPPYGERLGDRAEMPKLYRALGDTLRQRFVGWRAAVLAGDVELGRAMQL
HADKRYALYNGALETVLLTFDLKTREQPPREAKPLSAGAQMLKNRLEKNARHLRKRLARE
AIHCWRAYDQDLPEYAAAIDVYGDTRGDEHLHIQEYRAPADVPADMARLRLREIARVAGE
VFGVPRERIVLKTRERGKGGSKYGQFDQRGEFIEVEEGGLKFLVNLTDYLDTGLFLDHRL
VRAKLRELARGKCFLNLFAYTATASVYAAAGGALETTSVDLSATYLEWASRNLVLNDFSG
ARHRLMQFDAMEFLQRDRGHYGLVYVDPPTFSNSKRAEDFDVQRDHVALLEACNERLTRD
GVIVFSNNFRRFKLDREALQAHFEIEDWSAPSIPFDFARRGDIHGCWLLRRRQAVTGINP
WENARPKT