Protein Info for LRK53_RS13950 in Rhodanobacter sp000427505 FW510-R12

Annotation: thioredoxin TrxC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF21352: Zn_ribbon_Thio2
  • amino acids 9 to 33 (25 residues), 46 bits, 5.6e-16
• PF00085: Thioredoxin
  • amino acids 42 to 141 (100 residues), 89.7 bits, E=1.6e-29
• TIGR01068: thioredoxin
  • amino acids 45 to 142 (98 residues), 102.4 bits, E=6.6e-34
• PF13098: Thioredoxin_2
  • amino acids 53 to 142 (90 residues), 34 bits, E=4.8e-12

Best Hits

Swiss-Prot: 49% identical to THIO3_CORNE: Thioredoxin C-3 from Corynebacterium nephridii

KEGG orthology group: K03672, thioredoxin 2 [EC: 1.8.1.8] (inferred from 66% identity to tmz:Tmz1t_0651)

MetaCyc: 45% identical to reduced thioredoxin 2 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Thioredoxin" in subsystem Glycine reductase, sarcosine reductase and betaine reductase

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.8

Use Curated BLAST to search for 1.8.1.8

Protein Sequence (147 amino acids)

>LRK53_RS13950 thioredoxin TrxC (Rhodanobacter sp000427505 FW510-R12)
MSTPLAIPCPHCGALNRVPAERVGEHPNCGRCKQPLFEGHPVELTTANFDAIAGRGDLPV
LVDFWAPWCGPCVGFAPVFVQAAGKFEPRLRLAKLDTEAQPQLAGRFGIRSIPTLIMFKQ
GREIARQSGALNAAQLTQFVESALARG