Protein Info for LRK53_RS13935 in Rhodanobacter sp000427505 FW510-R12

Annotation: cytochrome c biogenesis protein DipZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 573 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 40 to 64 (25 residues), see Phobius details amino acids 70 to 91 (22 residues), see Phobius details amino acids 117 to 145 (29 residues), see Phobius details amino acids 158 to 182 (25 residues), see Phobius details amino acids 196 to 213 (18 residues), see Phobius details PF02683: DsbD_TM" amino acids 3 to 204 (202 residues), 32.8 bits, see alignment E=8.9e-12 PF08534: Redoxin" amino acids 273 to 385 (113 residues), 43.8 bits, see alignment E=4.5e-15 PF00578: AhpC-TSA" amino acids 275 to 378 (104 residues), 43.2 bits, see alignment E=7.4e-15 PF17991: Thioredoxin_10" amino acids 428 to 573 (146 residues), 169.2 bits, see alignment E=1.6e-53

Best Hits

Predicted SEED Role

"DipZ protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (573 amino acids)

>LRK53_RS13935 cytochrome c biogenesis protein DipZ (Rhodanobacter sp000427505 FW510-R12)
MLVLILAYLGGVLTILSPCILPVLPFVFARSDRPFMRNGFPMLLGMAITFAAVATLAALG
GSWAVHANQYGRWVAMAVLAVLGLTLLSTRLAEWITRPFVALGNRLSQRSAADGDSIWGS
AGLGVATGLLWAPCAGPILGLLLTGAALNGASVQTTLLLLIYAAGAATSLGLALLIGGQV
FALMKRSLGAGEWVRRALGVLVLGGVAAIALGLDTGVLTRVSLASTGGIEQKLINAVRPA
PAPRPAPKAGEPLPVEGTFPSLAGATQWLNSPPLTAESLRGKVVLVDFWTYSCINCIRAL
PYARGWADKYKDHGLVVIGVHAPEFAFEKDPVNVAKAVKDLGVDYPVALDNDYAIWKGFN
NEYWPAHYFIDTQGQIRHHHFGEGEYRESEDVIRQLLADAGQNNLPGGYVSDDHRGVEAA
ASDDLTRSPETYVGYARTMNFVGGRVARDETHDYRAPASLAANQWSLDGRWTVRDENAQL
DRAGGAIVYRFRGRDLHLVLGPASDGKPIRYRVSIDGQPPGADHGMDTDAEGNGTVTGQR
LYQLVRQAGGSGERLFEITFLDPGVQAYAFTFG