Protein Info for LRK53_RS13850 in Rhodanobacter sp000427505 FW510-R12

Annotation: peptidylprolyl isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 PF00254: FKBP_C" amino acids 5 to 82 (78 residues), 45.8 bits, see alignment E=3.1e-16

Best Hits

Swiss-Prot: 46% identical to SLYD_HAEIN: FKBP-type peptidyl-prolyl cis-trans isomerase SlyD (slyD) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K03775, FKBP-type peptidyl-prolyl cis-trans isomerase SlyD [EC: 5.2.1.8] (inferred from 67% identity to hel:HELO_3074)

MetaCyc: 46% identical to FKBP-type peptidyl-prolyl cis-trans isomerase SlyD (Escherichia coli K-12 substr. MG1655)
Peptidylprolyl isomerase. [EC: 5.2.1.8]; RXN-22956 [EC: 5.2.1.8]

Predicted SEED Role

"FKBP-type peptidyl-prolyl cis-trans isomerase SlyD (EC 5.2.1.8)" in subsystem Peptidyl-prolyl cis-trans isomerase or Potassium homeostasis (EC 5.2.1.8)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (160 amino acids)

>LRK53_RS13850 peptidylprolyl isomerase (Rhodanobacter sp000427505 FW510-R12)
MQIAQNAVAAFHYTLTDDDGQVIDSSAGREPLTYLHGSGHIVPGLEKQMEGRAAGDKFTA
HVAPEEGYGVRHEELMQEVPRAAFQGVEDIQPGMQFQGNGPEGQVNVTVTKVENDVVFID
ANHPLAGKTLHFAIEVTDVRGATAEELAHGHVHGAGGHHH