Protein Info for LRK53_RS13725 in Rhodanobacter sp000427505 FW510-R12

Annotation: nicotinamide riboside transporter PnuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details transmembrane" amino acids 25 to 43 (19 residues), see Phobius details amino acids 50 to 67 (18 residues), see Phobius details amino acids 87 to 105 (19 residues), see Phobius details amino acids 112 to 130 (19 residues), see Phobius details amino acids 137 to 155 (19 residues), see Phobius details amino acids 162 to 179 (18 residues), see Phobius details TIGR01528: nicotinamide mononucleotide transporter PnuC" amino acids 2 to 182 (181 residues), 73 bits, see alignment E=1.5e-24 PF04973: NMN_transporter" amino acids 2 to 181 (180 residues), 176.1 bits, see alignment E=3.4e-56

Best Hits

KEGG orthology group: K03811, nicotinamide mononucleotide transporter (inferred from 57% identity to smt:Smal_0149)

Predicted SEED Role

"Ribosyl nicotinamide transporter, PnuC-like" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation or PnuC-like transporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (195 amino acids)

>LRK53_RS13725 nicotinamide riboside transporter PnuC (Rhodanobacter sp000427505 FW510-R12)
MSWVELVAALVSAWAVWLTTRRRPWCWPVGLVSVLVYAWVFVHAKLYSDALLQLAFAVLI
GYGWWRWLQHLGGDGRVEVAALPPRQAIAHLAIGCLGALALGAFMHYRTDAALPWLDAAL
TAFSLVAQWWQAKRHVASWWLWIAVDVIYVGEYVYKHLLITSVLYAGFVLLAVLGLHAWQ
RVAETAAPHELGTPP