Protein Info for LRK53_RS13645 in Rhodanobacter sp000427505 FW510-R12

Annotation: CinA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02464: CinA
  • amino acids 13 to 167 (155 residues), 190.3 bits, E=8.3e-61
• TIGR00199: amidohydrolase, PncC family
  • amino acids 21 to 166 (146 residues), 164.1 bits, E=1.2e-52

Best Hits

Swiss-Prot: 51% identical to PNCC_ECOLI: Nicotinamide-nucleotide amidohydrolase PncC (pncC) from Escherichia coli (strain K12)

KEGG orthology group: K03743, (no description) (inferred from 69% identity to xal:XALc_1169)

MetaCyc: 51% identical to NMN aminohydrolase (Escherichia coli K-12 substr. MG1655)
Nicotinamide-nucleotide amidase. [EC: 3.5.1.42]

Predicted SEED Role

"C-terminal domain of CinA type S; Protein Implicated in DNA repair function with RecA and MutS"

MetaCyc Pathways

• NAD salvage pathway II (PNC IV cycle) (5/5 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.42

Protein Sequence (169 amino acids)

>LRK53_RS13645 CinA family protein (Rhodanobacter sp000427505 FW510-R12)
MESSSVPTDAELQALAGEVATEVQRCRLMLVTAESCTGGWIAKTLTDLPGSSAWFDAGVV
TYSYEAKEALLGVNPRTLEHSGAVSEETALEMVSGALARFGAGVAVAVTGIAGPSGGTSD
KPVGTVWISWKRRGGYGHAQLFHFPGDREAVRRQTVAAALIGLRKTLTE