Protein Info for LRK53_RS13590 in Rhodanobacter sp000427505 FW510-R12

Annotation: phosphate regulon sensor histidine kinase PhoR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 TIGR02966: phosphate regulon sensor kinase PhoR" amino acids 26 to 350 (325 residues), 395.9 bits, see alignment E=6.4e-123 PF13188: PAS_8" amino acids 30 to 75 (46 residues), 27.4 bits, see alignment 4.9e-10 PF00512: HisKA" amino acids 136 to 198 (63 residues), 74.7 bits, see alignment E=9.9e-25 PF02518: HATPase_c" amino acids 243 to 350 (108 residues), 89.1 bits, see alignment E=5.4e-29

Best Hits

Predicted SEED Role

"Phosphate regulon sensor protein PhoR (SphS) (EC 2.7.13.3)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (364 amino acids)

>LRK53_RS13590 phosphate regulon sensor histidine kinase PhoR (Rhodanobacter sp000427505 FW510-R12)
MMTAPANASHLQYDRFMTRSRRIASSLRDLRNAASHLPDAVVLLDGQQQIRWFNHAAENL
LGLRRPLDRGASLQQRLAGSELAGWLRDGAHEPLTDATAPGRADSQLNVSLLPFGEHEQL
LLAHDISHQNRLEQVRRDFVANVSHELRTPLTVIHGYLELLDPEDVPELAPVLDEMRTQS
KRMGQIVEDLLTLSRLETQHEVVDERVPMAALLATVRKEAEALSQGRHRIVLESTAETDL
LGSPKDLHSALSNLASNAVRYTPAGGSIAIRWQRVADGAVYSVSDTGFGIPASHLARLTE
RFYRVSSSRSRESGGTGLGLSIVKHVLNLHQAQLKIESTPGAGSTFSCHFGPARLLAPGS
GNES