Protein Info for LRK53_RS13390 in Rhodanobacter sp000427505 FW510-R12

Annotation: FTR1 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 34 to 58 (25 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 105 to 125 (21 residues), see Phobius details amino acids 145 to 168 (24 residues), see Phobius details amino acids 177 to 200 (24 residues), see Phobius details amino acids 240 to 258 (19 residues), see Phobius details PF03239: FTR1" amino acids 3 to 255 (253 residues), 108.5 bits, see alignment E=2.1e-35

Best Hits

KEGG orthology group: K07243, high-affinity iron transporter (inferred from 53% identity to bcj:BCAL0606)

Predicted SEED Role

"High-affinity iron permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (280 amino acids)

>LRK53_RS13390 FTR1 family protein (Rhodanobacter sp000427505 FW510-R12)
MGAVALLVFREVLEAALIVSVVAAATRGVMRRGWFIGGGIALGVFGAVLVALSADLLASA
FSGAGQELFNAIVLLAAVLMIGWHVLWMSSHGRELSRQMRELGSAVHSGASSLGLLLAVV
ALAVLREGSEVVLFLYGMRAGGAGHLWTGLAIGTAAGAALGFALYAGLLRIPMRHFFGVT
NGMLVLLAAGLASTAARYLIQADLLPAWGNQLWDSSWLLGNGSVPGQTAHILIGYDAQPA
GMQLVFYGLTLVLLWMGARFAKRQPSTQTADGRAITHPVG