Protein Info for LRK53_RS13365 in Rhodanobacter sp000427505 FW510-R12

Annotation: isovaleryl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 PF02771: Acyl-CoA_dh_N" amino acids 8 to 119 (112 residues), 139.3 bits, see alignment E=1.4e-44 PF02770: Acyl-CoA_dh_M" amino acids 123 to 220 (98 residues), 85.3 bits, see alignment E=5.3e-28 PF00441: Acyl-CoA_dh_1" amino acids 232 to 380 (149 residues), 126 bits, see alignment E=2.8e-40 PF08028: Acyl-CoA_dh_2" amino acids 253 to 364 (112 residues), 29.2 bits, see alignment E=2e-10

Best Hits

Swiss-Prot: 65% identical to IVD_SOLTU: Isovaleryl-CoA dehydrogenase, mitochondrial (IVD) from Solanum tuberosum

KEGG orthology group: None (inferred from 80% identity to psu:Psesu_1634)

MetaCyc: 64% identical to isovaleryl-CoA dehydrogenase subunit (Pseudomonas aeruginosa PAO1)
RXN0-2301 [EC: 1.3.8.4]

Predicted SEED Role

"Isovaleryl-CoA dehydrogenase (EC 1.3.8.4)" (EC 1.3.8.4)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.3.8.4

Use Curated BLAST to search for 1.3.8.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (385 amino acids)

>LRK53_RS13365 isovaleryl-CoA dehydrogenase (Rhodanobacter sp000427505 FW510-R12)
MRPFPLGEDIDLLRESVHAFAEKEIAPRADRIDRDNLFPADLWRKFGEMGLLGVTVPETY
GGSGMGFLAHMVAMEEISRASGSVGLSYGAHSNLCLNNIFHNGNEVQRRKYLPKLCSGEH
VGALAMSEPGAGSDVVGSMSCKAELRGDVWVANGNKMWITNGPDADVLLVYMRTAPRPAG
SRCMTAFIVEKGMKGFSTAQKLDKLGMRGSNTCELVFDNCEIPAENIVGEVNEGVRVLMS
GLDTERLVLSGGPIGLMQAALDITLPYVRERKQFNAPIGTFEIMQAKVADMYTALQSSRG
FAYMVAQQFDSGVKSRIDPAACLLNASVNAVKVALEAIQSLGGNGYINEFPAGRLLRDAK
LYEIGAGTNEIRRMLIGRELFHGKA