Protein Info for LRK53_RS13300 in Rhodanobacter sp000427505 FW510-R12

Annotation: IS630 family transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 PF13384: HTH_23" amino acids 15 to 61 (47 residues), 34.3 bits, see alignment 4.5e-12 PF13518: HTH_28" amino acids 17 to 70 (54 residues), 34.9 bits, see alignment 3.7e-12 PF13551: HTH_29" amino acids 18 to 75 (58 residues), 37.8 bits, see alignment E=4.8e-13 PF13565: HTH_32" amino acids 45 to 125 (81 residues), 48.2 bits, see alignment E=4e-16 PF13592: HTH_33" amino acids 95 to 153 (59 residues), 70.3 bits, see alignment E=2.5e-23 PF13358: DDE_3" amino acids 168 to 299 (132 residues), 118.4 bits, see alignment E=7.2e-38

Best Hits

KEGG orthology group: None (inferred from 58% identity to maq:Maqu_0408)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (341 amino acids)

>LRK53_RS13300 IS630 family transposase (Rhodanobacter sp000427505 FW510-R12)
MRATDGRKLSHETLEAMRLRAVEAVESGESPETVIRTLGLSRPRIYEWLAAFREGGLEAL
RAKPISGRPRKLDERAMRWIHATVTTKNPQQLKFEFALWTRAMVRDLIARRFKVRLSEVS
VGRLLRELGLSPQRPLARAYQRDPARVEAWLHEEYPAIRKEAKRAKAQVFFADEASVRSD
YHSGTTWAPLGQTPTVERTGARFTLNFISAVSPRGELRFACCPGTLTTAKFIDFLKRLMV
HRDAPVFLVVDGHPVHRSRAVKQFVAGTQGQLRLFQLPPYSPDLNPDELVWNHLKRHKLG
RLALSGPDHLKRHAMAFLRALQKQPALVRGFFQHPTVRYAA