Protein Info for LRK53_RS13240 in Rhodanobacter sp000427505 FW510-R12

Annotation: chloride channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 transmembrane" amino acids 12 to 40 (29 residues), see Phobius details amino acids 51 to 73 (23 residues), see Phobius details amino acids 149 to 174 (26 residues), see Phobius details amino acids 186 to 204 (19 residues), see Phobius details amino acids 223 to 245 (23 residues), see Phobius details amino acids 261 to 281 (21 residues), see Phobius details amino acids 301 to 324 (24 residues), see Phobius details amino acids 331 to 376 (46 residues), see Phobius details amino acids 378 to 403 (26 residues), see Phobius details PF00654: Voltage_CLC" amino acids 82 to 397 (316 residues), 226 bits, see alignment E=3.9e-71

Best Hits

KEGG orthology group: None (inferred from 65% identity to oca:OCAR_6400)

Predicted SEED Role

"voltage-gated chloride channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (453 amino acids)

>LRK53_RS13240 chloride channel protein (Rhodanobacter sp000427505 FW510-R12)
MRRFCLTEPLVMLVTVLQWLVLAIFTGALVGAGCTLFLRALFATEGHAYAAPWWVLALAL
PLGGLANGLLLHYGYRLRRSTFSDNVIVAVNEQHGKLPFRTMWIKPVCALITLACGGSAG
KEGPCSHIGASLAAAVGRMLHLNPEMRKRLLACGVSAGFSSVFGTPIAGAIYGVEMLAIG
RIRHDFLFPAIVGGVTSFEVSRWLGVPYPHYVIDFSGQFTELLFLKTVLIGVLCGGVAWL
FVELLGQARKLFGGLKQRWALWPPLVPMLGGVVLALLILLVPTDYLGLSLPLMERALHGE
AMPWLGFVWKALLVAITLGSGFYGGIVTPQFVLGAVAGGAFAHLFGLTPALGAAVGLTAV
VAAASNAPIAAILMGVELYGADATLYVAGACVAAYLIIGHRSVYPEQQIAFSKSSWIFAR
ADLPVGQEKVRLSYGLLRWWRMRRRSRKSGSGE