Protein Info for LRK53_RS13135 in Rhodanobacter sp000427505 FW510-R12

Annotation: glutathione S-transferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 PF02798: GST_N" amino acids 1 to 75 (75 residues), 39 bits, see alignment E=2.1e-13 PF13417: GST_N_3" amino acids 5 to 80 (76 residues), 61 bits, see alignment E=2.8e-20 PF13409: GST_N_2" amino acids 10 to 75 (66 residues), 42.5 bits, see alignment E=2e-14 PF00043: GST_C" amino acids 112 to 195 (84 residues), 29.8 bits, see alignment E=1.5e-10 PF13410: GST_C_2" amino acids 128 to 188 (61 residues), 37.7 bits, see alignment E=4.4e-13

Best Hits

KEGG orthology group: K00799, glutathione S-transferase [EC: 2.5.1.18] (inferred from 70% identity to bgf:BC1003_0892)

Predicted SEED Role

"Maleylacetoacetate isomerase (EC 5.2.1.2) / Glutathione S-transferase" in subsystem Gentisare degradation or Homogentisate pathway of aromatic compound degradation or Salicylate and gentisate catabolism (EC 5.2.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18, 5.2.1.2

Use Curated BLAST to search for 2.5.1.18 or 5.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (219 amino acids)

>LRK53_RS13135 glutathione S-transferase family protein (Rhodanobacter sp000427505 FW510-R12)
MPLQLYAHRFSSYCQKVLIALYENGIAFEWRVLTPDDAVTDAEFTALWPIRRFPLLRDGE
RTAVESGIIIEYLDRHYPGTAPLIPVDADTALEARAMDRFFDHYVHTPLQKIVFDSLRPA
ADRDPYGVKEARALLDTAYAWLERKLAGRHWATGGDFSLADCSAAPALFYADWTHRIPAS
CINVTAYRQRLLARPSFARAVDEARPYRPYFPLGAPDRD