Protein Info for LRK53_RS13025 in Rhodanobacter sp000427505 FW510-R12

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 29 to 50 (22 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 89 to 110 (22 residues), see Phobius details amino acids 118 to 137 (20 residues), see Phobius details amino acids 144 to 161 (18 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 199 to 219 (21 residues), see Phobius details amino acids 225 to 244 (20 residues), see Phobius details amino acids 255 to 275 (21 residues), see Phobius details amino acids 281 to 299 (19 residues), see Phobius details PF00892: EamA" amino acids 28 to 159 (132 residues), 71.3 bits, see alignment E=4.9e-24 amino acids 169 to 297 (129 residues), 50.2 bits, see alignment E=1.7e-17

Best Hits

Swiss-Prot: 32% identical to SAM_RICPR: S-adenosylmethionine uptake transporter (sam) from Rickettsia prowazekii (strain Madrid E)

KEGG orthology group: None (inferred from 56% identity to psu:Psesu_1237)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>LRK53_RS13025 DMT family transporter (Rhodanobacter sp000427505 FW510-R12)
MRATSNCPATALDPIPASPPVPTPLPLRAVLLMLGSAGFFALMAVTIRFASAQLHPFQIT
FFRSAFGALFALPLLHGHGWALLRTPRFGFYVMRCVLGMGGMLAGFWAIVNLPLAEAVAL
SYSSPLFVTIGAVIFLGEVVRRRRWSAVVAGFIGVLVIVRPGSAAFAAGSLVALLAAALT
GAVTISIKSLTGSEPADRIVLLTTLLWVPLSLPAALAVWQWPHAAIWPWLVLSGALGTSG
HWCWTRALRLADASLLAPFSYLQLLIVAVLAWWIFGEQVDRYTAAGAAIIIGASLYIAHR
EHSLARQRRREVRAANAEPPI