Protein Info for LRK53_RS13010 in Rhodanobacter sp000427505 FW510-R12

Annotation: ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 493 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 300 to 321 (22 residues), see Phobius details amino acids 330 to 351 (22 residues), see Phobius details amino acids 356 to 374 (19 residues), see Phobius details amino acids 419 to 441 (23 residues), see Phobius details amino acids 456 to 478 (23 residues), see Phobius details PF04069: OpuAC" amino acids 22 to 277 (256 residues), 179.7 bits, see alignment E=8.5e-57 PF00528: BPD_transp_1" amino acids 314 to 483 (170 residues), 81.9 bits, see alignment E=5.1e-27

Best Hits

KEGG orthology group: K05846, osmoprotectant transport system permease protein (inferred from 66% identity to xal:XALc_0692)

Predicted SEED Role

"L-proline glycine betaine binding ABC transporter protein ProX (TC 3.A.1.12.1) / Osmotic adaptation" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (493 amino acids)

>LRK53_RS13010 ABC transporter permease subunit (Rhodanobacter sp000427505 FW510-R12)
MLLAACLLLGPCLQPAPAQAAPVRIGSKQFTESVILGELALAGAREAGIDAMHRRELGGT
RILWRALLDGEIDAYPEYTGTLTQELLKGMPANADIASLRARLKPLGVGITDSLGFSDSY
ALGMRDDVAARLGIRDISDLLQHPGLRFGFSNEFMDRGDGWPGLRQRYGLPQAKVSGLDH
ALSYRAVASGAVDAIDLYSTDAEIPYYHLRTLRDDRHYFPRYDAVYLYRLALEQSAPAFV
GVLRKFAGSIDEDAMRAMNARVKLRGVKENVVAASFLGIHAHDHEGGRWTQLLQRSVEHL
RLVAISLGLAMLLAIPLGILAARRRRLGQWLIGLTGILQTVPSLAMFVFMIPLLGIGTWP
AIAALFLYSLLPIVRNTHAGLIGIAPELRESAAALGLPPGVRLRWVELPLAMRSILAGIK
TAAVINVGTATLAALIGAGGYGQPILTGIRLDDVGLILQGAIPAAVLALLVQGLFELVER
RLTPRGLRLEARQ