Protein Info for LRK53_RS12790 in Rhodanobacter sp000427505 FW510-R12

Annotation: UDP-N-acetylmuramate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00179: UDP-N-acetylenolpyruvoylglucosamine reductase
  • amino acids 13 to 339 (327 residues), 202.4 bits, E=4.7e-64
• PF01565: FAD_binding_4
  • amino acids 27 to 149 (123 residues), 64.3 bits, E=1e-21
• PF02873: MurB_C
  • amino acids 216 to 339 (124 residues), 96.5 bits, E=9.3e-32

Best Hits

Swiss-Prot: 52% identical to MURB_CHRVO: UDP-N-acetylenolpyruvoylglucosamine reductase (murB) from Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

KEGG orthology group: K00075, UDP-N-acetylmuramate dehydrogenase [EC: 1.1.1.158] (inferred from 52% identity to smt:Smal_1723)

Predicted SEED Role

"UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.1.1.158)" in subsystem Peptidoglycan Biosynthesis or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 1.1.1.158)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (10/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (6/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan recycling I (10/14 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (10/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (11/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (11/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (10/17 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.158

Protein Sequence (342 amino acids)

>LRK53_RS12790 UDP-N-acetylmuramate dehydrogenase (Rhodanobacter sp000427505 FW510-R12)
MGGYTLVENAPLAKRNTLRVDARATLLAEIRDAAKLPELLDFPAVRHSRLLVLGEGSNML
FTSDFDGTVLAMATRGVQVEEGGDSARIAVAAGERWDDFVRWTLGQGYAGLENLILIPGT
VGAAPIQNIGAYGCEVAEFVESVEAWDTRERRVVTLDHATCAFAYRDSLFKHQLGRYVVT
AVRFVLPRSRPLRTDYAGIDEELARMGVDKPAPFHVAEAVVRLRMRKLPDPAVIGNAGSF
FKNPIVDAALAEALQREHPALAAWPQPDGRCKISAAWLIETTGFKGIREGDAGISNRHAL
VLVNHGHATGPQLWTLAQQVMHGVRDRFGVQLEPEPVVIGTR