Protein Info for LRK53_RS12735 in Rhodanobacter sp000427505 FW510-R12

Annotation: DsbE family thiol:disulfide interchange protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 transmembrane" amino acids 7 to 23 (17 residues), see Phobius details TIGR00385: periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily" amino acids 4 to 172 (169 residues), 160.8 bits, see alignment E=1.2e-51 PF00578: AhpC-TSA" amino acids 38 to 153 (116 residues), 55.1 bits, see alignment E=7.4e-19 PF08534: Redoxin" amino acids 38 to 164 (127 residues), 59.7 bits, see alignment E=2.9e-20

Best Hits

Swiss-Prot: 43% identical to DSBE_ALLVD: Thiol:disulfide interchange protein DsbE (dsbE) from Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)

KEGG orthology group: K02199, cytochrome c biogenesis protein CcmG, thiol:disulfide interchange protein DsbE (inferred from 67% identity to xca:xccb100_2601)

MetaCyc: 46% identical to thiol:disulfide oxidoreductase CcmG (Escherichia coli K-12 substr. MG1655)
1.8.4.-; RXN-21424; RXN-21425

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmG/DsbE, thiol:disulfide oxidoreductase" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (180 amino acids)

>LRK53_RS12735 DsbE family thiol:disulfide interchange protein (Rhodanobacter sp000427505 FW510-R12)
MSRLLPFIGFMLLVGLFGFGIWWNTQHDPNAIPTPLLNKPAPEFNLPKLYEPAQTVSKAD
LLGRPYLLNVFASWCIECGVEHPVLTAEGPTLGVELVGYNYKDAPDDAKGWLAKHGNPYN
LLIADEPGHTAIDFGVYGAPESFLIDAKGVIRYKHIGPLTPEVMAKELKPAIAAMLKEAP