Protein Info for LRK53_RS12710 in Rhodanobacter sp000427505 FW510-R12

Annotation: heme exporter protein CcmB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 transmembrane" amino acids 28 to 46 (19 residues), see Phobius details amino acids 52 to 75 (24 residues), see Phobius details amino acids 104 to 126 (23 residues), see Phobius details amino acids 132 to 157 (26 residues), see Phobius details amino acids 167 to 190 (24 residues), see Phobius details amino acids 200 to 224 (25 residues), see Phobius details PF03379: CcmB" amino acids 12 to 224 (213 residues), 202.6 bits, see alignment E=2.7e-64 TIGR01190: heme exporter protein CcmB" amino acids 13 to 223 (211 residues), 206.9 bits, see alignment E=1.4e-65

Best Hits

Swiss-Prot: 50% identical to CCMB_PSEAE: Heme exporter protein B (ccmB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02194, heme exporter protein B (inferred from 57% identity to xal:XALc_1297)

Predicted SEED Role

"ABC transporter involved in cytochrome c biogenesis, CcmB subunit" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>LRK53_RS12710 heme exporter protein CcmB (Rhodanobacter sp000427505 FW510-R12)
MNRPSLASACAAMLRRDLTLAWRRRGDIAMPVLYALIVTMLFPFALGPEDTLLQRIAGGV
VLVTVLLAMLLALDAMFASDIEDGSLEQLVLAPQPLALLLGMKILAHWLATALPLIVIAP
LMAAMLHLPGAVIPVLLLALALATPLLSLLGAVLVALTAGTRRSGMLLALMLLPLCVPTV
IFAAGAVAAAQQGLPWFAPVAWLAAALVLVVVLAPLACAAALRIALDA