Protein Info for LRK53_RS12695 in Rhodanobacter sp000427505 FW510-R12

Annotation: FAD-dependent monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF13450: NAD_binding_8" amino acids 9 to 38 (30 residues), 26.6 bits, see alignment (E = 9e-10) PF01266: DAO" amino acids 9 to 206 (198 residues), 29.8 bits, see alignment E=6.8e-11 PF01494: FAD_binding_3" amino acids 86 to 206 (121 residues), 28.9 bits, see alignment E=1.1e-10 amino acids 327 to 382 (56 residues), 42.2 bits, see alignment 9.6e-15

Best Hits

Predicted SEED Role

"Kynurenine 3-monooxygenase (EC 1.14.13.9)" in subsystem NAD and NADP cofactor biosynthesis global (EC 1.14.13.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (500 amino acids)

>LRK53_RS12695 FAD-dependent monooxygenase (Rhodanobacter sp000427505 FW510-R12)
MAQQPITLIGGGLVGTLLAQQLARRGFAVEVFEKRPDPRRAGFLGGCSSAFGNRSRHCST
SGIPAVACARSTGPSMGGGRSINLALAERGLQALRTAGLADDVLQRAVMMRGRMVHDRDG
RSALQRYGVDDSEVIWSVSRGALNMLLLDAAEAAGVRFHFGQSLTGADFGQQRIRLADEA
GTERERDAGLLIGADGAGSALRAAMNAYAPLGERIESLGHGYKELEIPPAGELPAALQQQ
GSGREQFALEPHALHIWPRGGYMCIALPNAEGSFTVTLFLPAQGAAPSFAALPDVAAART
FFATDFPDLLPLIPRFDEDFDSHPVGTLSTLYLERWHLDGRALLIGDAAHAIVPFHGQGM
NCGFEDTVALADLLAAAPDDSAGVFAEFQRVRQPNADAIAAMALENYVEMRDSVADPRYL
AKRELGSALAARIPGHYMARYRLVTFTHVPYAYALERGRAQDRLLEQLLRDTPNAAAVDL
DAAGRLFQAKLEPLPRLRHG