Protein Info for LRK53_RS12685 in Rhodanobacter sp000427505 FW510-R12

Annotation: acetoacetyl-CoA reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR01829: acetoacetyl-CoA reductase" amino acids 9 to 251 (243 residues), 346.7 bits, see alignment E=3.8e-108 PF00106: adh_short" amino acids 10 to 202 (193 residues), 202.2 bits, see alignment E=1.2e-63 PF01370: Epimerase" amino acids 11 to 147 (137 residues), 30.1 bits, see alignment E=6.4e-11 PF08659: KR" amino acids 12 to 184 (173 residues), 94.9 bits, see alignment E=1.2e-30 PF13561: adh_short_C2" amino acids 19 to 249 (231 residues), 205.8 bits, see alignment E=1.5e-64

Best Hits

Swiss-Prot: 44% identical to FABG_VIBCH: 3-oxoacyl-[acyl-carrier-protein] reductase FabG (fabG) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00023, acetoacetyl-CoA reductase [EC: 1.1.1.36] (inferred from 62% identity to aeh:Mlg_2486)

Predicted SEED Role

"Acetoacetyl-CoA reductase (EC 1.1.1.36)" in subsystem Acetyl-CoA fermentation to Butyrate or Polyhydroxybutyrate metabolism or Serine-glyoxylate cycle (EC 1.1.1.36)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.36

Use Curated BLAST to search for 1.1.1.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (253 amino acids)

>LRK53_RS12685 acetoacetyl-CoA reductase (Rhodanobacter sp000427505 FW510-R12)
MTRTNPSSRLALVTGGIGGLGTEICRQLARAGRKVIALDLASRAERVAAFHDEVADFGGA
IAFEPVDVSDFDGCRQLVERVEQQHGGIDILVNAAGITRDASLRKMTPQQWHELLQVNLD
GVFNMCRQVVEGMTARSFGRIVNISSVNGQTGQFGQTNYSAAKAGVHGFSMALARETARK
GVTVNTVSPGYCDTPMVAAVPDEIRAQIIAAIPVGRLGSPADIARAVAFLAADDAGYITG
ANLPVNGGYFMSF