Protein Info for LRK53_RS12630 in Rhodanobacter sp000427505 FW510-R12

Annotation: succinate dehydrogenase, cytochrome b556 subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 130 transmembrane" amino acids 25 to 49 (25 residues), see Phobius details amino acids 58 to 79 (22 residues), see Phobius details amino acids 107 to 128 (22 residues), see Phobius details PF01127: Sdh_cyt" amino acids 4 to 120 (117 residues), 110.2 bits, see alignment E=3.4e-36 TIGR02970: succinate dehydrogenase, cytochrome b556 subunit" amino acids 5 to 122 (118 residues), 131.5 bits, see alignment E=9.4e-43

Best Hits

KEGG orthology group: K00241, succinate dehydrogenase cytochrome b-556 subunit (inferred from 62% identity to xal:XALc_1826)

Predicted SEED Role

"Succinate dehydrogenase cytochrome b-556 subunit" in subsystem Succinate dehydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (130 amino acids)

>LRK53_RS12630 succinate dehydrogenase, cytochrome b556 subunit (Rhodanobacter sp000427505 FW510-R12)
MADTQRPLSPHLQVYRWQIQMVTSILHRATGIALAIGTLLVVWGLLALASGEATFAQFRI
CIGSPLGLILLLGWSWALSYHLCNGIRHLVQDTGAGYAIPQFVRSSWLSVVGSVVLTVVI
WAFVLIGGVA