Protein Info for LRK53_RS12570 in Rhodanobacter sp000427505 FW510-R12

Annotation: tetraacyldisaccharide 4'-kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details PF02606: LpxK" amino acids 19 to 321 (303 residues), 361.2 bits, see alignment E=2.5e-112 TIGR00682: tetraacyldisaccharide 4'-kinase" amino acids 25 to 311 (287 residues), 248.1 bits, see alignment E=6.2e-78

Best Hits

Swiss-Prot: 53% identical to LPXK_STRM5: Tetraacyldisaccharide 4'-kinase (lpxK) from Stenotrophomonas maltophilia (strain R551-3)

KEGG orthology group: K00912, tetraacyldisaccharide 4'-kinase [EC: 2.7.1.130] (inferred from 53% identity to smt:Smal_1399)

Predicted SEED Role

"Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130)" in subsystem KDO2-Lipid A biosynthesis or Lipopolysaccharide-related cluster in Alphaproteobacteria (EC 2.7.1.130)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.130

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>LRK53_RS12570 tetraacyldisaccharide 4'-kinase (Rhodanobacter sp000427505 FW510-R12)
MALIDTLESAWYGNGRAPWWTAPLAALYGGVIRLRGALYRRGWLHSVRLPVPVVVIGNLT
VGGTGKTPLTIVLARALRERGCRPGVISRGYGGSQREPLLLGDAPDPAQVGDEPCLIRAG
GVPVAVGRDRPAAAQLLLDAGCDVLIADDGLQHYRLARDVEVCVIDGVRRFGNRRLLPAG
PLREPLDRLRRVDLRVCNGGAAEAGEYPMQLHGGEAMALDGSRTQALAGFAGQRVHAVAA
IGNPRRFFDSLRGHGIEVIGHAFADHHDFVAAELDFGDGLPLLMTDKDAVKCRRFARPNW
WRVPVQAQLPDAFYAVLLEQLDGLCRKTGSPAT