Protein Info for LRK53_RS12265 in Rhodanobacter sp000427505 FW510-R12

Annotation: protein-L-isoaspartate(D-aspartate) O-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 TIGR00080: protein-L-isoaspartate O-methyltransferase" amino acids 18 to 224 (207 residues), 203.8 bits, see alignment E=1.5e-64 PF01135: PCMT" amino acids 22 to 223 (202 residues), 191.2 bits, see alignment E=2.1e-60 PF13649: Methyltransf_25" amino acids 96 to 167 (72 residues), 27.7 bits, see alignment E=3.6e-10

Best Hits

Swiss-Prot: 59% identical to PIMT_XANCP: Protein-L-isoaspartate O-methyltransferase (pcm) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K00573, protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC: 2.1.1.77] (inferred from 62% identity to xal:XALc_1158)

MetaCyc: 52% identical to protein-L-isoaspartate O-methyltransferase (Escherichia coli K-12 substr. MG1655)
Protein-L-isoaspartate(D-aspartate) O-methyltransferase. [EC: 2.1.1.77]

Predicted SEED Role

"Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77)" in subsystem Ton and Tol transport systems (EC 2.1.1.77)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.77

Use Curated BLAST to search for 2.1.1.77

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (226 amino acids)

>LRK53_RS12265 protein-L-isoaspartate(D-aspartate) O-methyltransferase (Rhodanobacter sp000427505 FW510-R12)
MTTYPLSAADLKGEGMTSQRARDRLVAVLKDSGIRDPRVIEVIRNLPRHHFIDQALHAHA
YENDALPIGHGQTISQPWVVARMTEALLEFGVPQKVLEIGTGSGYQAAVLAALVPQVFTV
ERIEALLRQARRRFRQLGLTNLRSRYDDGKLGWPGEAPFDAIILTAASDTIPTRILDQLS
PTGVLVAPVGSPSRQTLIRMRSDGQGDFIQEELGAVSFVPLLGGIG