Protein Info for LRK53_RS12090 in Rhodanobacter sp000427505 FW510-R12

Annotation: DNA polymerase III subunit epsilon

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01406: DNA polymerase III, epsilon subunit
  • amino acids 2 to 233 (232 residues), 298 bits, E=4.8e-93
• TIGR00573: exonuclease, DNA polymerase III, epsilon subunit family
  • amino acids 4 to 214 (211 residues), 199.2 bits, E=6.3e-63
• PF00929: RNase_T
  • amino acids 4 to 166 (163 residues), 124.5 bits, E=3.3e-40

Best Hits

KEGG orthology group: K02342, DNA polymerase III subunit epsilon [EC: 2.7.7.7] (inferred from 61% identity to xcv:XCV1090)

Predicted SEED Role

"DNA polymerase III epsilon subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Protein Sequence (236 amino acids)

>LRK53_RS12090 DNA polymerase III subunit epsilon (Rhodanobacter sp000427505 FW510-R12)
MRQIVLDTETTGLEVRQGHRLVEIACVELVERRLTGRHYQTYLNPDRAIDQGARLVTGIE
DEFLLDKPRFAEVATEFLAFIDGAELIIHNASFDIGFLDAELARLGEHAGRIGDRCSVLD
TLAMARERYPGQRNSLDALCKRLGVDNSRRDLHGGLIDAQLLADVYLAMTSGQVAFDLGF
EGASEQLDVMVAAPVVLHVRPRVLRASAEELSAHEQRLDALDKSGADGQSVWRRLG