Protein Info for LRK53_RS11975 in Rhodanobacter sp000427505 FW510-R12

Annotation: ribonuclease III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 TIGR02191: ribonuclease III" amino acids 4 to 212 (209 residues), 234.9 bits, see alignment E=3.8e-74 PF14622: Ribonucleas_3_3" amino acids 9 to 129 (121 residues), 115.4 bits, see alignment E=3e-37 PF00636: Ribonuclease_3" amino acids 28 to 118 (91 residues), 81.9 bits, see alignment E=7.7e-27 PF00035: dsrm" amino acids 144 to 212 (69 residues), 46.9 bits, see alignment E=5.2e-16

Best Hits

Swiss-Prot: 57% identical to RNC_XANCP: Ribonuclease 3 (rnc) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K03685, ribonuclease III [EC: 3.1.26.3] (inferred from 62% identity to psu:Psesu_1987)

Predicted SEED Role

"Ribonuclease III (EC 3.1.26.3)" in subsystem RNA processing and degradation, bacterial or Two cell division clusters relating to chromosome partitioning (EC 3.1.26.3)

Isozymes

Compare fitness of predicted isozymes for: 3.1.26.3

Use Curated BLAST to search for 3.1.26.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (219 amino acids)

>LRK53_RS11975 ribonuclease III (Rhodanobacter sp000427505 FW510-R12)
MEPNYRFRDPTLAQLALTHRSVGRPNNERLEFLGDALLGAIVAEMLYEAHPKASEGELSR
LRAQLVNGQALAVVARELALGDGLKLGPGELKSGGFRRDSILADAFEAMVAAVYQDGGFD
ACREFVRGLFAERIVALRRSSKDAKTRLQEWLQAKGLPLPQYELVASHGEDHAKTFDVSC
SIGEPLAFIAEAHGGSRRAAEQDAAETVLNRLLEQQRDA