Protein Info for LRK53_RS11940 in Rhodanobacter sp000427505 FW510-R12

Annotation: 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01938: TRAM
  • amino acids 13 to 62 (50 residues), 30 bits, 9.5e-11
• TIGR00479: 23S rRNA (uracil-5-)-methyltransferase RumA
  • amino acids 19 to 438 (420 residues), 339.9 bits, E=1.1e-105
• PF05958: tRNA_U5-meth_tr
  • amino acids 275 to 445 (171 residues), 78.9 bits, E=9.8e-26
• PF01135: PCMT
  • amino acids 285 to 354 (70 residues), 27.6 bits, E=6e-10
• PF13847: Methyltransf_31
  • amino acids 301 to 376 (76 residues), 38.5 bits, E=2.4e-13
• PF13649: Methyltransf_25
  • amino acids 303 to 356 (54 residues), 30.5 bits, 1.2e-10

Best Hits

Swiss-Prot: 61% identical to RLMD_XANC5: 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (rlmD) from Xanthomonas campestris pv. vesicatoria (strain 85-10)

KEGG orthology group: K03215, RNA methyltransferase, TrmA family [EC: 2.1.1.-] (inferred from 61% identity to xcv:XCV1381)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (447 amino acids)

>LRK53_RS11940 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (Rhodanobacter sp000427505 FW510-R12)
MSRSNSAPSTPFEAHITALAHDGRGVARIDGKTVFVSGALLGEQVTAKLRKRHRHFDEAE
VVEVLVASPHRVEPRCRHFAECSGCSLQHLDAAAQIEAKQRVLAENFERIGKVAPASWLP
PLTAEPWGYRRKGRLSVRNVAKKGRVLVGFREEQNPRFVTEIQQCEVMHPALGPKVGLLA
ELLGTMDAVNDVPQIEFAAGDDLMALVFRHMQPLSEHDLAALTAFGQQHGFAIYLQPGGT
SSVHPLWPEHPRLAFRIASGDARYADVELEFQPLDFVQVNAGMNQLMMARAMELLDPQPT
DRVLDLFCGLGNFTLPIARRVAEVVGVEGEHGLVERAAQNAARNGIANACFHVANLFEDQ
RAADWAKQPWDKLLLDPPRAGADKLLDYLPHKQTRRIVYISCHPASLARDAGILVERHGF
RLAAAGVMDMFPHTSHVESIALFERSS