Protein Info for LRK53_RS11910 in Rhodanobacter sp000427505 FW510-R12

Annotation: trans-2-enoyl-CoA reductase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 transmembrane" amino acids 278 to 287 (10 residues), see Phobius details PF12242: Eno-Rase_NADH_b" amino acids 2 to 80 (79 residues), 120.3 bits, see alignment E=3.5e-39 PF12241: Enoyl_reductase" amino acids 83 to 317 (235 residues), 357.3 bits, see alignment E=5.2e-111 PF07055: Eno-Rase_FAD_bd" amino acids 326 to 389 (64 residues), 108.4 bits, see alignment E=2.8e-35

Best Hits

Swiss-Prot: 71% identical to FABV_XANOM: Enoyl-[acyl-carrier-protein] reductase [NADH] (fabV) from Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

KEGG orthology group: None (inferred from 74% identity to xal:XALc_0021)

Predicted SEED Role

"Short-chain alcohol dehydrogenase family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (400 amino acids)

>LRK53_RS11910 trans-2-enoyl-CoA reductase family protein (Rhodanobacter sp000427505 FW510-R12)
MIIKPKVRGFICVTAHPVGCERNVLDQIAITEAAGHARSKGPKRVLVIGASTGYGLASRI
TAAFGYGAATLGVFFEKPSSHDKTGTAGWYNAAAFDKAAKAAGLYSKSINGDAFAHETRA
KAIEIIKNEMGGPIDLVVYSLASPVRKLPDTGEVVRSALKTIGEPFHNTSVDTNKDMVIE
ATVEPATEQEIKDTVTVMGGEDWALWIDALSQAGVLAEHAKTIAYSYIGTEITWPMYWHG
TLGQAKQHLDDTAKQLRSRHPDLEAYVGVMKSVVTQASAAIPVIPLYVSIAFKIMKEKGI
HENPIEQANRLFHDRLYRADGAAALTDDEGRIRLDDWELRDDVQDACKTLWPTVTTENLR
EITDYAGYKHEFLKLFGFDRDDVDYDAEVEADRRFDCLEG