Protein Info for LRK53_RS11820 in Rhodanobacter sp000427505 FW510-R12

Annotation: phospholipase D-like domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 transmembrane" amino acids 429 to 448 (20 residues), see Phobius details amino acids 454 to 472 (19 residues), see Phobius details PF13091: PLDc_2" amino acids 237 to 358 (122 residues), 79.7 bits, see alignment E=1.8e-26

Best Hits

Predicted SEED Role

"Cardiolipin synthetase (EC 2.7.8.-)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (488 amino acids)

>LRK53_RS11820 phospholipase D-like domain-containing protein (Rhodanobacter sp000427505 FW510-R12)
MPTPLTPATPSRLLAEQALSRAAGAPLLSGNAVDLLIDATAHYEAWLAAICGARQRVLLE
NYIIRDDEVGRAFRDALVERARAGVFVAVVVDWLGCLGQSGRAFWAPLRAAGGEVRVFNP
LQLGEPLGWVSRDHRKLLVVDGELGFLSGVCISAKWLGDPARGVPPWRDTGVALRGPAVA
ELEAAFAQSWGETGAALRPFAEAPEPAMPAAHVSLRLIATQPSTAATYRLDQLIAAMARK
TLWLTDAYFVGLAPYVQALVAAARDGVDVRLLVPGSSDIPIVAGMSRSGYRPLLKAGIRV
FEWNGSMLHAKTAVADGQWARVGSSNLNIASWLGNRELDVAVEDAGFAGQLAAQYEQDLG
NATEIVLASRRRRHGSGSRERVCRSKARVPHVRHAGGSSGRAAAGALRIANSVGAALANR
RVLDDTGSGSLVIGTLVLGALAVVGFAWPAGIGWPLGALAAWFALNLGIRSWRVRKRRWR
ELRNADDD