Protein Info for LRK53_RS11805 in Rhodanobacter sp000427505 FW510-R12

Annotation: heavy metal translocating P-type ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 751 transmembrane" amino acids 113 to 134 (22 residues), see Phobius details amino acids 146 to 166 (21 residues), see Phobius details amino acids 178 to 200 (23 residues), see Phobius details amino acids 206 to 224 (19 residues), see Phobius details amino acids 359 to 379 (21 residues), see Phobius details amino acids 385 to 404 (20 residues), see Phobius details amino acids 691 to 715 (25 residues), see Phobius details TIGR01525: heavy metal translocating P-type ATPase" amino acids 181 to 729 (549 residues), 412.1 bits, see alignment E=4.6e-127 PF00122: E1-E2_ATPase" amino acids 249 to 341 (93 residues), 76.9 bits, see alignment E=1.4e-25 TIGR01494: HAD ATPase, P-type, family IC" amino acids 254 to 713 (460 residues), 180.6 bits, see alignment E=4e-57 PF00702: Hydrolase" amino acids 437 to 641 (205 residues), 66.9 bits, see alignment E=4.8e-22

Best Hits

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoI; Copper-translocating P-type ATPase (EC 3.6.3.4)" (EC 3.6.3.4)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.4

Use Curated BLAST to search for 3.6.3.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (751 amino acids)

>LRK53_RS11805 heavy metal translocating P-type ATPase (Rhodanobacter sp000427505 FW510-R12)
MNAYAAWAHPQLAAQVLRPRRDGCSEIALRVEALNDARQVLWLEQRISALPGVQRVAIDR
PAQRVRVVWDARRMSLPTLLDNFAAANCPAQPLQHGSIDDARAHEQHDALKRLLVAGMCS
MQVMTYAFVIYIGVVDFVDFSTRSLFRWLGLLTTLPVVFYSALPFFRGAIRELGERRLGI
NLPVALAVLLVFLASAFHTLRGSGEIYFDSVTMFVFLLLAGRYVELRSRHRSGALGDAAI
DATPLLAQRRRADGELETVAAIALLPGDRVHVAEGEAVPADGVLESAGARVDEALLSGES
RPVRRQRGERLVAGSVLLSGPVELRVEHGGSASTAARLGALADRARQARARVAPSDRVIG
RFVARVLVLTALTALGWLLVDPSRAFEAAVAVLVVACPCSFALARPAALTRALGVLAARG
VLVTDGKALEALARVDYALFDKTGTLGVPKLDRRGIEPLRGDTPERVLQLAAALAHESSH
PLARALADAARQQALALQAQSVRVHAGAGISGEADGRTLRLGRADFALAPSGGQLPADAD
ALVLADADGAIAAFHLVEQPRAGARRLLDALRADGIAVAIASGDHAARVAALADRLDVAD
RHARQSPEDKLARLQAAHAEGRITLAVGDGSNDAPLLAGADVSAALASGTELAQSHADLL
LLDGHLGSLADARAIARQLQRVIRQGRHWSLWYNLAAVPFAAFGLVTPWLAAIGMSLSSL
LVVLYALRVGCGAPGPVDAPHPPLHPRELHA