Protein Info for LRK53_RS11795 in Rhodanobacter sp000427505 FW510-R12

Annotation: cytochrome-c oxidase, cbb3-type subunit III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details TIGR00782: cytochrome c oxidase, cbb3-type, subunit III" amino acids 39 to 293 (255 residues), 227.2 bits, see alignment E=1.3e-71 PF14715: FixP_N" amino acids 39 to 85 (47 residues), 41.9 bits, see alignment 9.7e-15 PF13442: Cytochrome_CBB3" amino acids 128 to 203 (76 residues), 42.1 bits, see alignment E=1.4e-14 amino acids 216 to 290 (75 residues), 45.3 bits, see alignment E=1.3e-15 PF00034: Cytochrom_C" amino acids 131 to 207 (77 residues), 33.3 bits, see alignment E=1.5e-11 amino acids 216 to 291 (76 residues), 37.3 bits, see alignment E=8.6e-13

Best Hits

Swiss-Prot: 43% identical to CCOP1_PSEST: Cbb3-type cytochrome c oxidase subunit CcoP1 (ccoP1) from Pseudomonas stutzeri

KEGG orthology group: None (inferred from 52% identity to gpb:HDN1F_27240)

Predicted SEED Role

"Cytochrome c oxidase subunit CcoP (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (302 amino acids)

>LRK53_RS11795 cytochrome-c oxidase, cbb3-type subunit III (Rhodanobacter sp000427505 FW510-R12)
MSTGWSFWVMFLVVLNMGITFFLYLWGPRAKIPTLPDGTSGHVWAHGVLREGVRPLPLWW
VLLSGAMFVAGFVYLALFPGFGNFKGVLGWTSHGELANAVAANDAKRAPLVERFKLYPVE
QLASDPAALQMGKVLFEDNCAACHQRSAKGNVALGAPDLSDNDWLYGGSGSDITTSIHDG
RSGVMPPWASLGADNVKNLAQYVLSLSGSPHDAAKAAAGQPLFATCAACHGADGKGNQAL
GAPNLTDHIWLHGGSVADIEKTIGEGRQGHMPAWSPRLSDDQIRVLAAYVYHQSHQGDAG
KP