Protein Info for LRK53_RS11755 in Rhodanobacter sp000427505 FW510-R12

Annotation: thioredoxin-disulfide reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 8 to 298 (291 residues), 168.9 bits, see alignment E=4.3e-53 TIGR01292: thioredoxin-disulfide reductase" amino acids 9 to 313 (305 residues), 398.1 bits, see alignment E=8.8e-124 PF13738: Pyr_redox_3" amino acids 73 to 285 (213 residues), 64.1 bits, see alignment E=3.3e-21 PF00070: Pyr_redox" amino acids 149 to 225 (77 residues), 62.9 bits, see alignment E=8.3e-21

Best Hits

Swiss-Prot: 71% identical to TRXB_VIBCH: Thioredoxin reductase (trxB) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00384, thioredoxin reductase (NADPH) [EC: 1.8.1.9] (inferred from 81% identity to psu:Psesu_1541)

MetaCyc: 69% identical to thioredoxin reductase (Escherichia coli K-12 substr. MG1655)
Thioredoxin-disulfide reductase. [EC: 1.8.1.9]

Predicted SEED Role

"Thioredoxin reductase (EC 1.8.1.9)" in subsystem Glycine reductase, sarcosine reductase and betaine reductase or Thioredoxin-disulfide reductase or Wyeosine-MimG Biosynthesis (EC 1.8.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.9

Use Curated BLAST to search for 1.8.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>LRK53_RS11755 thioredoxin-disulfide reductase (Rhodanobacter sp000427505 FW510-R12)
MSPPKHSHLLILGSGPAGYTAAVYAARGNLKPTMITGLQQGGQLMTTTDVDNWPGDVEGL
QGPALMQRMAEHAERFHTEMIFDHIHTVDLKQRPFRLKGDSGEYTADALIIATGATAKYL
GIASEEKFKGKGVSACATCDGFFFRDQDVVVIGGGNTAVEEALYLANIARKVYLVHRRDK
LRAEKIMQDKLFEKAAAGKIELVWNHTIDEVLGDDTGVTGVRVKDVNSGATRDIAATGFF
VAIGHTPNTGIFEGQLDMHDGYIKIHSGQHGMATMTSVPGVFAAGDVADHIYRQAVTSAG
FGCMAALDAERWLDQQTPAG