Protein Info for LRK53_RS11715 in Rhodanobacter sp000427505 FW510-R12

Annotation: NADH-quinone oxidoreductase subunit H

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 100 to 123 (24 residues), see Phobius details amino acids 137 to 159 (23 residues), see Phobius details amino acids 175 to 192 (18 residues), see Phobius details amino acids 232 to 252 (21 residues), see Phobius details amino acids 261 to 285 (25 residues), see Phobius details amino acids 297 to 315 (19 residues), see Phobius details PF00146: NADHdh" amino acids 14 to 310 (297 residues), 102.1 bits, see alignment E=1.9e-33

Best Hits

KEGG orthology group: None (inferred from 67% identity to reh:H16_A2197)

Predicted SEED Role

"Formate hydrogenlyase subunit 4" in subsystem Formate hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>LRK53_RS11715 NADH-quinone oxidoreductase subunit H (Rhodanobacter sp000427505 FW510-R12)
MNALAPVSQLGGVVLAVALAPLLAGWVAQCRAWLQSRSAPSLLLPYRTLRKLFRKDAALA
TQASPLFRATPYAVFGAMATAAAIIPSVTTDLPLARVADAIALVGLFATARMFIALAAMD
IGTVFGSMGARREMMIGFLAEPALLMVLFNAFLMFGSTALPTIVKGTLDADGLTLHPSLA
FAGVAFVMVLLAENARIPIDNPGTHLEVTMIHESMVLEYSARHLALIEWASWLKLFNYAC
IGFTLFVPWGIAPHTAGPSGLLLAIVWLLVKLAVAGAVLAVIETVSAKLRIFRAPEFLSM
AFLLAVLGLLVHLLLQS