Protein Info for LRK53_RS11650 in Rhodanobacter sp000427505 FW510-R12

Annotation: aspartate/glutamate racemase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 TIGR00035: aspartate racemase" amino acids 1 to 230 (230 residues), 244.7 bits, see alignment E=4.8e-77 PF01177: Asp_Glu_race" amino acids 7 to 222 (216 residues), 173.8 bits, see alignment E=2.2e-55

Best Hits

Swiss-Prot: 59% identical to YGEA_ECOBD: L-aspartate/glutamate-specific racemase (ygeA) from Escherichia coli (strain B / BL21-DE3)

KEGG orthology group: K01779, aspartate racemase [EC: 5.1.1.13] (inferred from 67% identity to tmz:Tmz1t_3053)

MetaCyc: 59% identical to amino acid racemase YgeA (Escherichia coli K-12 substr. MG1655)
5.1.1.-

Predicted SEED Role

"Aspartate racemase (EC 5.1.1.13)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 5.1.1.13)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (233 amino acids)

>LRK53_RS11650 aspartate/glutamate racemase family protein (Rhodanobacter sp000427505 FW510-R12)
MRTLGLIGGMSWESTVSYYREINEGVKQQLGGLHSARLLLFSVDFHEIEQLQHAGEWEKA
GEVLAQAASALERAGAEGLVICTNTMHKVAAQVQSAVSIPLLHIADPTAAAIKAAGLTRI
GLLGTRFTMEQDFYRKRLESHGLEVLIPGEEDRAVVHAVIYDELCLGIVREESRKKYLGI
IDRLVGNGAQAIILGCTEISLLIRPTDTRVPLFDTTAIHAADAVRWSLEGGPI