Protein Info for LRK53_RS11610 in Rhodanobacter sp000427505 FW510-R12

Annotation: low molecular weight phosphotyrosine protein phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01451: LMWPc
  • amino acids 5 to 140 (136 residues), 119 bits, E=1e-38

Best Hits

Swiss-Prot: 45% identical to ETP_ECOLI: Low molecular weight protein-tyrosine-phosphatase Etp (etp) from Escherichia coli (strain K12)

KEGG orthology group: K01104, protein-tyrosine phosphatase [EC: 3.1.3.48] (inferred from 50% identity to psu:Psesu_2991)

MetaCyc: 45% identical to phosphotyrosine-protein phosphatase Etp (Escherichia coli K-12 substr. MG1655)
Protein-tyrosine-phosphatase. [EC: 3.1.3.48]

Predicted SEED Role

"Low molecular weight protein-tyrosine-phosphatase Wzb (EC 3.1.3.48)" in subsystem Colanic acid biosynthesis (EC 3.1.3.48)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.48

Protein Sequence (144 amino acids)

>LRK53_RS11610 low molecular weight phosphotyrosine protein phosphatase (Rhodanobacter sp000427505 FW510-R12)
MFKRILIVCTGNICRSPVAEYLFRQRMAGRDIEFASAGLGALVGSPMDATALQLLAENGI
DGSMHRAHQLTPSTLRGADLVLGMEKGHVAAMVRLAPEVHGKVYLFDKWLHDKDIPDPYR
QQRKVFEHVHQIITQGISSWEPYL