Protein Info for LRK53_RS11575 in Rhodanobacter sp000427505 FW510-R12

Annotation: cation:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 60 to 80 (21 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 123 to 142 (20 residues), see Phobius details amino acids 154 to 176 (23 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details amino acids 226 to 258 (33 residues), see Phobius details amino acids 272 to 290 (19 residues), see Phobius details amino acids 300 to 322 (23 residues), see Phobius details amino acids 333 to 356 (24 residues), see Phobius details amino acids 362 to 385 (24 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 20 to 386 (367 residues), 241.8 bits, see alignment E=5.7e-76

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (401 amino acids)

>LRK53_RS11575 cation:proton antiporter (Rhodanobacter sp000427505 FW510-R12)
MHHASEILFTLFVVFVAAQVGGEIAQRLKLPGVVGEIAAGCAIGPSLLGWITPEQIATGT
PLDVLAELGVILLLFAVGLETRLEDLKKVGKVAFTVGVVGVLVPFGMGSVWAHGNGLDWD
RSLFVAAAFVATSAGITARVLQELNALQRIESKVILGAAVIDDVLAMLLLGVVVSLQGGG
SIDAAHLLVVLAGAVGFIAVIGWGGARVMRWNSAWLDKPLGPHSPLMIVLALCLGLAWLS
TRFGLAAIIGAFLAGMIASETRQQHTLEKQTQPLLALLTPFFFVVTGSKVDLHELASAEA
LWMLAVVTAIAIVSKLVGGWLGSLTLGTRSATIIGFGMVPRGEVGIVVATLGLAAGVFDN
RIYAIIVAMSLLTAMVTPPVLAWLLKRSAGAGPVEVPDVRG