Protein Info for LRK53_RS11555 in Rhodanobacter sp000427505 FW510-R12

Annotation: EF-P lysine aminoacylase EpmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details PF00152: tRNA-synt_2" amino acids 8 to 314 (307 residues), 135.4 bits, see alignment E=1.2e-43 TIGR00462: EF-P lysine aminoacylase GenX" amino acids 9 to 313 (305 residues), 356.8 bits, see alignment E=5.4e-111

Best Hits

KEGG orthology group: K04568, lysyl-tRNA synthetase, class II [EC: 6.1.1.6] (inferred from 74% identity to xca:xccb100_2689)

Predicted SEED Role

"Translation elongation factor P Lys34:lysine transferase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.6

Use Curated BLAST to search for 6.1.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (318 amino acids)

>LRK53_RS11555 EF-P lysine aminoacylase EpmA (Rhodanobacter sp000427505 FW510-R12)
MGRVPLAALQLRARLYALVRAYFAEQRVLEVETPMLSAAGNTEPNIEGFSTMFSGHVDAG
ARERWLRTSPEHPLKRLLAAGIGDCYELGRVFRNGEAGGRHNPEFTMLEWYRVGWDHRQL
MQETVALVEAALAMVGRRAELVVTSYRQLFLDELGIDPAHAAIDTLRAPLAESGIDPAGL
GHDDWLDLLITHKLQPAFPRDRITVIHDYPASQCALARIRPGEPPLAERFELYLGRYELA
NGYHELNDAAEQRARFERDNARRRARGLREVPLDERLLGVLDALPDCAGVALGVERLLMC
LADTDAIADVLAFAFSEA