Protein Info for LRK53_RS11540 in Rhodanobacter sp000427505 FW510-R12

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 58 to 82 (25 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 124 to 148 (25 residues), see Phobius details amino acids 159 to 182 (24 residues), see Phobius details amino acids 195 to 213 (19 residues), see Phobius details amino acids 248 to 270 (23 residues), see Phobius details amino acids 285 to 306 (22 residues), see Phobius details amino acids 314 to 332 (19 residues), see Phobius details amino acids 341 to 365 (25 residues), see Phobius details amino acids 377 to 397 (21 residues), see Phobius details amino acids 404 to 423 (20 residues), see Phobius details PF00083: Sugar_tr" amino acids 23 to 234 (212 residues), 65 bits, see alignment E=6.6e-22 PF07690: MFS_1" amino acids 35 to 331 (297 residues), 84.9 bits, see alignment E=5.5e-28

Best Hits

KEGG orthology group: None (inferred from 62% identity to pen:PSEEN5474)

Predicted SEED Role

"L-Proline/Glycine betaine transporter ProP" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (430 amino acids)

>LRK53_RS11540 MFS transporter (Rhodanobacter sp000427505 FW510-R12)
MQAAPVDNFPSDRLRRRDVKTLLLSALGGALEFYDFVVFVFFAIPLSHLFFPPDTTPWLA
QLQVFGIFAAGYLARPLGGIVMAHYGDTLGRKRMFTLSVFLMAVPTLAIGLLPVYAQIGM
LAPLLLLLLRVVQGIAVGGEVPGAWVFVAEHVPPKRIGFACASLTSGLTVGILIGSLVAA
AINGRMSPTEVLDHGWRLPFLAGGVFGFVAVWLRRWLSETPVFEAMHARKELASGLPLRL
VFERHLPGVLLSVLVTWMLTAAIVVLILMTPTLAQSVFHVVPARAFLGNSVASFALALGC
LFYGWLADRIGHARALLAGAIGLLACGYALYIDLQAGAVHFVALYALAGFAVGVVGVVPA
LMVAAFPPPVRFSGLSFSYNIAYALFGGLTPPLIGWLLKPFGVLAPAHYVALTAIIGIAV
AYTQLRRRHA