Protein Info for LRK53_RS11415 in Rhodanobacter sp000427505 FW510-R12

Annotation: ferric iron uptake transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 PF01475: FUR" amino acids 11 to 130 (120 residues), 145.7 bits, see alignment E=3.6e-47

Best Hits

Swiss-Prot: 59% identical to FUR_PSEAE: Ferric uptake regulation protein (fur) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03711, Fur family transcriptional regulator, ferric uptake regulator (inferred from 72% identity to xcb:XC_2767)

Predicted SEED Role

"Ferric uptake regulation protein FUR" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Iron acquisition in Vibrio or Oxidative stress or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (140 amino acids)

>LRK53_RS11415 ferric iron uptake transcriptional regulator (Rhodanobacter sp000427505 FW510-R12)
MEQETKELRRVGLKVTHPRMRILQVFDEEGTQHLTAEDVYKKLLAHQEDIGLATVYRVLT
QFEAAGIIVKHNFEGGQAVYELDRGKHHDHMIDVDSGKVVEFISEEIERLQHEIAAKHGY
VIEDHSLVLYVRPKQRAHKG