Protein Info for LRK53_RS11380 in Rhodanobacter sp000427505 FW510-R12

Annotation: molecular chaperone DnaJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 PF00226: DnaJ" amino acids 5 to 67 (63 residues), 91.4 bits, see alignment E=4.6e-30 TIGR02349: chaperone protein DnaJ" amino acids 5 to 345 (341 residues), 438 bits, see alignment E=1.6e-135 PF01556: DnaJ_C" amino acids 118 to 329 (212 residues), 170.9 bits, see alignment E=3.2e-54 PF00684: DnaJ_CXXCXGXG" amino acids 144 to 203 (60 residues), 53.1 bits, see alignment E=5e-18

Best Hits

Swiss-Prot: 67% identical to DNAJ_STRM5: Chaperone protein DnaJ (dnaJ) from Stenotrophomonas maltophilia (strain R551-3)

KEGG orthology group: K03686, molecular chaperone DnaJ (inferred from 68% identity to xal:XALc_1676)

MetaCyc: 59% identical to chaperone protein DnaJ (Escherichia coli K-12 substr. MG1655)
1.8.4.-

Predicted SEED Role

"Chaperone protein DnaJ" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (375 amino acids)

>LRK53_RS11380 molecular chaperone DnaJ (Rhodanobacter sp000427505 FW510-R12)
MSKRDYYEVLGVERSVSEAELKKSFRRLAMKYHPDRCPDDPTAQDKFKEAKEAYEVLSDT
SKRAMYDQHGHAAFENGMGGRGGAGFGDMGDIFGDIFGDIFGRSGGGRGRPRRGADLRYI
IELGLEEAVFGVSRQIEVPTQVNCQHCNGSGSEDGKVSKCKTCNGHGQVRMQNGIFSIQQ
ACPHCGGSGQAIEKPCRECHGEGRLEEARTLSVQIPEGVDNGDRIRLSGQGEAGPAGAPA
GDLYVEVRVREHEIFQRDGNDLYCELPIRFSQAALGAELPVPTLEGEVPVSIPPETQTGT
QFRLRGRGVKSVRSSRHGDLICRVVVETPVRLTRQQRELLESLEATFAGSDAGKHTPRAK
GWVDGVKKFWSRVTA