Protein Info for LRK53_RS11195 in Rhodanobacter sp000427505 FW510-R12

Annotation: 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00048: 23S rRNA (adenine(2503)-C(2))-methyltransferase
  • amino acids 6 to 361 (356 residues), 471.3 bits, E=8.8e-146
• PF21016: RlmN_N
  • amino acids 11 to 70 (60 residues), 97.7 bits, E=2.6e-32
• PF04055: Radical_SAM
  • amino acids 115 to 285 (171 residues), 65.1 bits, E=9.4e-22

Best Hits

Swiss-Prot: 66% identical to RLMN_XANC8: Dual-specificity RNA methyltransferase RlmN (rlmN) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K06941, ribosomal RNA large subunit methyltransferase N [EC: 2.1.1.-] (inferred from 66% identity to xcc:XCC1982)

MetaCyc: 56% identical to 23S rRNA m2A2503 methyltransferase/tRNA m2A37 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11586 [EC: 2.1.1.192]; 2.1.1.- [EC: 2.1.1.192]

Predicted SEED Role

"Ribosomal RNA large subunit methyltransferase N (EC 2.1.1.-)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.192

Protein Sequence (376 amino acids)

>LRK53_RS11195 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN (Rhodanobacter sp000427505 FW510-R12)
MNKVVASSNKVNLLDFDRQGLRDFFTQIGEKPYRAEQVMKWIYHDLEDNFENMTDVGKAL
RAKLTEACTIGAPKTLLDKVATDGTHKWLLGMDSGNAIETVYIPEPTRGTLCVSSQIGCA
LNCQFCSTGAQGFNRNLSTAEIIGQVWVAAKYLGNVTHQNRRITNVVMMGMGEPLANFDN
VLKAMKLMRDDLGFGLAAKRVTLSTAGLVPLIDQLSDAIDVSLAVSLHAANDELRTELMP
INKRYPLAELLAACQRWIARKPRTSITFEYTLMQGVNDQPEHARQLIKLMRKLPTCKVNL
IPFNPFPGTQFKRSAPDDIHQFQTQLLNAGVLTMLRRTRGDDIDAACGQLAGQVADRTRR
SASIRKRQDEGATHAI